| Entry |
Lividin-5 |
| Uniprot code |
C3RSZ6 |
| Fasta |
C3RSZ6 |
| Peptide names |
Lividin-5 Ranacyclin-B-RL1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana livida |
| Ecozone |
Indomalaya |
| Distribution |
Known definitely only from the type locality (Myanmar) near the Thai border, although animals have been referred, apparently in error, to this taxon, from northeastern India to southern China |
| Antimicrobial & other activities |
antibacterial, antifungal, trypsin inhibitor |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLFLFFLGIVSLSFCEQERDADEEDGGRVTEEEVKRAALRGCWTKSIPPKPCP
GKR
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yan et al. / Amino Acids (2011) DOI 10.1007/s00726-011-1079-8. Bi-functional peptides with both trypsin-inhibitory and antimicrobial activities are frequent defensivemolecules in Ranidae amphibian skins |