| Entry |
Lividin-8 |
| Uniprot code |
C3RT00 |
| Fasta |
C3RT00 |
| Peptide names |
Lividin-8 Odorranain-O-RA Odorranain-O-OA1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana livida |
| Ecozone |
Indomalaya |
| Distribution |
Known definitely only from the type locality (Myanmar) near the Thai border, although animals have been referred, apparently in error, to this taxon, from northeastern India to southern China |
| Antimicrobial & other activities |
mast cell degranulation, histamine releasing |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFVLGTINLSLCEQERGADEEDGGEAKLEDIKRAVPLIYNRPGIYVTKRP
KGK
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |