| Entry |
Antimicrobial peptide |
| Uniprot code |
C3RT13 |
| Fasta |
C3RT13 |
| Peptide names |
Antimicrobial peptide Ranacyclin-B-LK2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Limnonectes |
| Species |
Limnonectes kuhlii |
| Ecozone |
Indomalaya |
| Distribution |
Mountains of Java; populations of closely related, but apparently unnamed species, from Assam (India) to Indochina to the Greater Sundas as far as Sulawesi, Indonesia |
| Antimicrobial & other activities |
antibacterial, trypsin inhibitor |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGIVSLSLCGQERDADEEDGGEVTEEDVKRSALVGCWTKSWPPKPCF
GR
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yan et al. / Amino Acids (2011) DOI 10.1007/s00726-011-1079-8. Bi-functional peptides with both trypsin-inhibitory and antimicrobial activities are frequent defensivemolecules in Ranidae amphibian skins |