| Entry |
Antioxidant peptide 1 |
| Uniprot code |
C4MR35 |
| Fasta |
C4MR35 |
| Peptide names |
Antioxidant peptide 1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana nigrovittata |
| Ecozone |
Indomalaya |
| Distribution |
Nepal and West Bengal, Assam. and Meghalaya (India) as well as adjacent Bangladesh to Yunnan and Guangxi (China), Vietnam and south to Malaya |
| Antimicrobial & other activities |
antioxidant |
| Tissue |
Skin |
| Sequence |
MFTLKKSLVLLFVMGTINLTLCEQEKGADEEDGGEARLEEIKRAMRMTYNRPCLYATKRT
KEM
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLVLLFVMGTINLTLC |
| | |
| Prepro | | 21 | | EQEKGADEEDGGEARLEEIKR | | | | | Bioactive | Antioxidant peptide 1 | 20 | No | AMRMTYNRPCLYATKRTKEM | | | |
|