| Entry |
Amolopkinin PPB W1 |
| Uniprot code |
C4PLD0 |
| Fasta |
C4PLD0 |
| Peptide names |
Amolopkinin PPB W1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops wuyiensis |
| Ecozone |
Palearctic |
| Distribution |
Forest streams of Zhejiang, northern Fujian and eastern Anhui, China |
| Antimicrobial & other activities |
inhibition of BK-induced muscle contraction |
| Tissue |
Skin |
| Sequence |
MFTSKKSILLLFFLGAISLSLCEEERDADEDDTEGEAKVENVKRVALPPGFTPFRVAPEI
V
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
X. Zhou et al. / Peptides 30 (2009) 893-900. Amolopkinins W1 and W2--novel bradykinin-related peptides (BRPs) from the skin of the Chinese torrent frog, Amolops wuyiensis: antagonists of bradykinin-induced smooth muscle contraction of the rat ileum |