| Entry |
Amolopin-p2 |
| Uniprot code |
C5H0C8 |
| Fasta |
C5H0C8 |
| Peptide names |
Amolopin-p2 Amolopin P2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops loloensis |
| Ecozone |
Palearctic |
| Distribution |
High-gradients streams in Zhaojue, Mianning, Hongya, Luding, and Baoxing in southern Sichuan, China, 1840-3700 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEQERGADEEENGGEVTEQEVKRNVLSSVANGINRALSF FG
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
A. Wang et al. / Biochimie 90 (2008) 863-867. A novel family of antimicrobial peptides from the skin of Amolops loloensis |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTISLSLC |
| | |
| Prepro | | 22 | | EQERGADEEENGGEVTEQEVKR | | | | | Bioactive | Amolopin-p2 | 18 | No | NVLSSVANGINRALSFFG | | | 20.1 |
|