| Entry |
Amolopin-8a |
| Uniprot code |
C5H0D3 |
| Fasta |
C5H0D3 |
| Peptide names |
Amolopin-8a |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops loloensis |
| Ecozone |
Palearctic |
| Distribution |
High-gradients streams in Zhaojue, Mianning, Hongya, Luding, and Baoxing in southern Sichuan, China, 1840-3700 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGMISLSLCKQERDANEERRDDPDENEENGGEAKVEEIQRGARPPLR CKAALC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGMISLSLC |
| | |
| Prepro | | 31 | | KQERDANEERRDDPDENEENGGEAKVEEIQR | | | | | Bioactive | Amolopin-8a | 13 | No | GARPPLRCKAALC | | | |
|