| Entry | Kininogen-1Ca |
| Uniprot code | C5IBR8 |
| Fasta | C5IBR8 |
| Peptide names | Kininogen-1Ca |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Lithobates |
| Species | Lithobates catesbeianus |
| Ecozone | Nearctic, Neotropic |
| Distribution | Eastern North America, except southern Florida, north to Nova Scotia, New Brunswick, southern Quebec, and southern Ontario (Canada), west to the central plains and south to Hidalgo, Puebla, and adjacent Veracruz (Mexico); introduced on Cuba, Isla de Juventud (= Isla de Pinos), Puerto Rico, Hispaniola, and Jamaica in the Antilles; introduced widely in the rest of the world including the Netherlands, Bordeaux region of France, Belgium, northern Italy, western Spain, Crete, Malaya (Malaysia), Java, Bali, Japan, southern and western Mexico, northern Thailand, Korea, and Taiwan (China) |
| Tissue | Skin |
| Sequence | MFTVKKSLLLLFFLGTISLSLCEQERDADEDENKREAQVKDVKRARSWGRIRRPPGCNPF RIAPASYLKRDDDVDEYAGEAKPKTLKERETREETGEGSDAQMGLPHFVLHQQSFNLELK II |
| Length | 122 |
| Signal peptide class | Class-1 |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTVKKSLLLLFFLGTISLSLC | |||||
| Prepro | 30 | EQERDADEDENKREAQVKDVKRARSWGRIR | |||||
| Bioactive | Kininogen-1Ca | 9 | No | RPPGCNPFR |