| Entry |
Sauvatide |
| Uniprot code |
C5J8E3 |
| Fasta |
C5J8E3 |
| Peptide names |
Sauvatide |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Antimicrobial & other activities |
contraction of urinary bladder smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MDILKKSLFLILFLGLVSISFCDGEKRQDDDEANESEEKKEIHEVEKRLRPAILVRTKGK
GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
L. Wang et al. / BBRC 383 (2009) 240-244. Sauvatide--a novel amidated myotropic decapeptide from the skin secretion of the waxy monkey frog, Phyllomedusa sauvagei |