| Entry |
Kasseptin 1Mb |
| Uniprot code |
C7C1K9 |
| Fasta |
C7C1K9 |
| Peptide names |
Kasseptin 1Mb Kassinatuerin-2Mb |
| Suborder |
Neobatrachia |
| Family |
Hyperoliidae |
| Genus |
Kassina |
| Species |
Kassina maculata |
| Ecozone |
Afrotropic |
| Distribution |
Coastal Kenya to northeastern Rep. South Africa through Tanzania, southern Malawi, eastern Zimbabwe, Swaziland, and Mozambique |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MLSLKKSMLLLFFLGMVSFSIADDKREDEGEDKRADEGEEKRAAEEKRFFGAIAAALPHV
ISAIKNALG
|
| Length |
69 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
L. Wang et al. / Peptides 30 (2009) 1428-1433. A family of kassinatuerin-2 related peptides from the skin secretion of the African hyperoliid frog, Kassina maculata |