Entry |
Kasseptin 1Md |
Uniprot code |
C7C1L1 |
Fasta |
C7C1L1 |
Peptide names |
Kasseptin 1Md Kassinatuerin-2Md |
Suborder |
Neobatrachia |
Family |
Hyperoliidae |
Genus |
Kassina |
Species |
Kassina maculata |
Ecozone |
Afrotropic |
Distribution |
Coastal Kenya to northeastern Rep. South Africa through Tanzania, southern Malawi, eastern Zimbabwe, Swaziland, and Mozambique |
Antimicrobial & other activities |
antibacterial, antifungal |
Tissue |
Skin |
Sequence |
MLSLKKSMLLLFFLGMVSFSIADDKREDEGEDKRADEGEEKRAVEKKRIIGAIAAALPHV INAIKNTFG
|
Length |
69 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
L. Wang et al. / Peptides 30 (2009) 1428-1433. A family of kassinatuerin-2 related peptides from the skin secretion of the African hyperoliid frog, Kassina maculata |