| Entry |
Tryptophyllin-2 |
| Uniprot code |
C7C1L9 |
| Fasta |
C7C1L9 |
| Peptide names |
Tryptophyllin-2 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Pachymedusa |
| Species |
Pachymedusa dacnicolor |
| Ecozone |
Neotropic |
| Distribution |
Pacific lowlands of Mexico from southern Sonora south (including the Balsas Depression to the state of Mexico) to the Isthmus of Tehuantepec |
| Antimicrobial & other activities |
contraction of urinary bladder smooth muscle cells |
| Tissue |
Skin |
| Sequence |
MDFLRKSLFLVLFLGFVSISFCDEEKREDDDENHGSEEKREIHEEGNQEERRDMSPPWHG
KK
|
| Length |
62 |
| Signal peptide class |
Class-1 |