| Entry |
Nigrosin-RA4 |
| Uniprot code |
D2K8C7 |
| Fasta |
D2K8C7 |
| Peptide names |
Nigrosin-RA4 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFPLKKSLLLLFFLGTISLSFCQDETNPEEERRDEEVVKMEEIKRGLLRGVLGVGKKIVC GLSGLC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFPLKKSLLLLFFLGTISLSFC |
| | |
| Prepro | | 23 | | QDETNPEEERRDEEVVKMEEIKR | | | | | Bioactive | Nigrosin-RA4 | 21 | No | GLLRGVLGVGKKIVCGLSGLC | | | |
|