| Entry |
Nigrosin-RA3 |
| Uniprot code |
D2K8D3 |
| Fasta |
D2K8D3 |
| Peptide names |
Nigrosin-MG3 Nigrosin-RA3 Nigrocin-OA1 Nigrocin-1-OA1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLFFLGTISLSLCQDETNAEEERRDEEVAKMEEIKRGLLSGVLGVGKKIVC
GLSGLC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |