Entry |
Nigrosin-RA3 |
Uniprot code |
D2K8G6 |
Fasta |
D2K8G6 |
Peptide names |
Nigrosin-MG3 Nigrosin-RA3 Nigrocin-OA1 Nigrocin-1-OA1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana andersonii |
Ecozone |
Indomalaya |
Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
Antimicrobial & other activities |
antibacterial, antifungal |
Tissue |
Skin |
Sequence |
MFTLKKPLLLLFFLGTISLSLCQDETNAEDERRDEEVAKMEEIKRGLLSGVLGVGKKIVC GLSGLC
|
Length |
66 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
X. Yang et al. / Journal of Proteome Research 11 (2012) 306-319. Extremely Abundant Antimicrobial Peptides Existed in the Skins of Nine Kinds of Chinese Odorous Frogs |