Entry |
Palustrin-RA2 |
Uniprot code |
D2K8I5 |
Fasta |
D2K8I5 |
Peptide names |
Palustrin-RA2 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana andersonii |
Ecozone |
Indomalaya |
Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTLKKSLLLLFFIGTISLSLCEQERDADEDEGETLEEVKRGLWDTIKQAGKKLFLNVLD KIRCKVAGGCRT
|
Length |
72 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKSLLLLFFIGTISLSLC |
| | |
Prepro | | 19 | | EQERDADEDEGETLEEVKR | | | | Bioactive | Palustrin-RA2 | 31 | No | GLWDTIKQAGKKLFLNVLDKIRCKVAGGCRT | | | |
|