| Entry |
Andersonin-8 |
| Uniprot code |
D2K8I8 |
| Fasta |
D2K8I8 |
| Peptide names |
Andersonin-8 Andersonin-T1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLFFLGTISLSLCEQERDADEEGNEENGGEAKLEVVKRGCSRWIIGIHDKF
VEIKKNYWNLNWKSGILFS
|
| Length |
79 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKPLLLLFFLGTISLSLC |
| | |
| Prepro | | 25 | | EQERDADEEGNEENGGEAKLEVVKR | | | | | Bioactive | Andersonin-8 | 32 | No | GCSRWIIGIHDKFVEIKKNYWNLNWKSGILFS | | | |
|