| Entry |
Dybowskin-1ST |
| Uniprot code |
D3X8H9 |
| Fasta |
D3X8H9 |
| Peptide names |
Chensirin-2 Dybowskin-1CDYa Dybowskin-1ST Preprotemporin-1CEc |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana dybowskii |
| Ecozone |
Palearctic |
| Distribution |
Russian Far East (excluding Sakhalin and the Kuriles) north to 63 degrees; Korea; eastern Mongolia and extreme northeastern China; Tsushima Island, Japan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEEERNAEEERRDYPEERDVEVEKRIIPLPLGYFAKKT
|
| Length |
59 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
Li-Li Jin et al. / Comparative Biochemistry and Physiology, Part B 154 (2009) 174-178. Characterization of antimicrobial peptides isolated from the skin of the Chinese frog, Rana dybowskii |