Entry |
Ranatuerin-2TOd |
Uniprot code |
D5MTH9 |
Fasta |
D5MTH9 |
Peptide names |
Ranatuerin-2TOd |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Rana |
Species |
Rana tagoi okiensis |
Ecozone |
Palearctic |
Distribution |
Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin, Brain |
Sequence |
MFTLKKSMLLLFFLGTISLSLCQEERGADEDDGGEMTEEVKRGLLNVIKDTAQNLFTAAL EKLKCKVTKCN
|
Length |
71 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISLSLC |
| | |
Prepro | | 20 | | QEERGADEDDGGEMTEEVKR | | | | Bioactive | Ranatuerin-2TOd | 29 | No | GLLNVIKDTAQNLFTAALEKLKCKVTKCN | | | |
|