| Entry |
Bradykinin-2 |
| Uniprot code |
D5MTI1 |
| Fasta |
D5MTI1 |
| Peptide names |
Bradykinin Bradykinin-2 [Thr6]-Bradykinin |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana tagoi okiensis |
| Ecozone |
Palearctic |
| Distribution |
Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
| Antimicrobial & other activities |
contraction of small intestine smooth muscle cells, relaxation of arterial smooth muscle cells |
| Tissue |
Skin, Brain |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEQERDADEDEYAGEAKAEDVKRAGYSRMIRRPPGFSPF
RIAPASTLKRDADEDEYAGEAKAEDVKRAGYSRMIRRPPGFTPFRIAPAIV
|
| Length |
111 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTISLSLC |
| | |
| Prepro | | 30 | | EQERDADEDEYAGEAKAEDVKRAGYSRMIR | | | | | Bioactive | Bradykinin | 9 | No | RPPGFSPFR | | | | | Prepro | | 30 | | TLKRDADEDEYAGEAKAEDVKRAGYSRMIR | | | | | Bioactive | [Thr6]-Bradykinin | 9 | No | RPPGFTPFR | | | |
|