| Entry |
Ranatuerin-2TGa |
| Uniprot code |
D5MTI4 |
| Fasta |
D5MTI4 |
| Peptide names |
Ranatuerin-2TGa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana tagoi |
| Ecozone |
Palearctic |
| Distribution |
Mountain regions of Honshu, Shikoku, and Kyushu Islands as well as Togoshima in the Oki Archipelago and Yakushima in the Tanegashima Group, Japan |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTISFSLCEEERGADKDDGGEITEEVKRGFLDVIKDTAQNLFATVL
DKIKCKVTKC
|
| Length |
70 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISFSLC |
| | |
| Prepro | | 20 | | EEERGADKDDGGEITEEVKR | | | | | Bioactive | Ranatuerin-2TGa | 28 | No | GFLDVIKDTAQNLFATVLDKIKCKVTKC | | | |
|