| Entry |
Granulosusin-B1 |
| Uniprot code |
E1AXE2 |
| Fasta |
E1AXE2 |
| Peptide names |
Daunchinain-A1 Granulosusin-B1 Pleurain-B-DN1 Pleurain-B-MT1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops granulosus |
| Ecozone |
Palearctic |
| Distribution |
Forest streams of eastern Sichuan and western Hubei, 650-1750 m elevation, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLFFLGTINLSLCEEERNAEEERRDDPDERDVEVEKRFLGGLLSSVLGPLG
KK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKPLLLLFFLGTINLSLC |
| | |
| Prepro | | 24 | | EEERNAEEERRDDPDERDVEVEKR | | | | | Bioactive | Granulosusin-B1 | 16 | No | FLGGLLSSVLGPLGKK | | | |
|