| Entry |
Granulosusin-D2 |
| Uniprot code |
E1AXE6 |
| Fasta |
E1AXE6 |
| Peptide names |
Granulosusin-D2 Palustrin-2ISa |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops granulosus |
| Ecozone |
Palearctic |
| Distribution |
Forest streams of eastern Sichuan and western Hubei, 650-1750 m elevation, China |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLLFLGTVSLSLCDQERAADEDEGEVIEEEVKRGFMDTAKNVAKNVAVTLL
DKLKCKITGGC
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
E. Iwakoshi-Ukena et al. / Peptides 32 (2011) 670-676. Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae |