| Entry |
Granulosusin-E1 |
| Uniprot code |
E1AXE7 |
| Fasta |
E1AXE7 |
| Peptide names |
Granulosusin-E1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops granulosus |
| Ecozone |
Palearctic |
| Distribution |
Forest streams of eastern Sichuan and western Hubei, 650-1750 m elevation, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLVLFFLGIVSLSLCEEERNADEDDGEMTEEVKRGILDTLKQLGKAAAQSLLS
KAACKLAKTC
|
| Length |
70 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLVLFFLGIVSLSLC |
| | |
| Prepro | | 19 | | EEERNADEDDGEMTEEVKR | | | | | Bioactive | Granulosusin-E1 | 29 | No | GILDTLKQLGKAAAQSLLSKAACKLAKTC | | | |
|