| Entry |
Temporin-GN3_2 |
| Uniprot code |
E1AXF3 |
| Fasta |
E1AXF3 |
| Peptide names |
Amolopin-2b Temporin-1CSa Temporin-GN3 Temporin-GN3_1 Temporin-LF3 Temporin-GN3_2 Temporin-1P Temporin-MT3 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops granulosus |
| Ecozone |
Palearctic |
| Distribution |
Forest streams of eastern Sichuan and western Hubei, 650-1750 m elevation, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEQERNAEEERRDDLGERQAEVEKRFLPIVGKLLSGLLG
K
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J.M. Conlon et al. / Peptides 28 (2007) 1268-1274. Peptide defenses of the Cascades frog Rana cascadae: implications for the evolutionary history of frogs of the Amerana species group |