| Entry |
Omeimontisin-B1 |
| Uniprot code |
E1AZ76 |
| Fasta |
E1AZ76 |
| Peptide names |
Omeimontisin-B1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana omeimontis |
| Ecozone |
Palearctic |
| Distribution |
Mountains of Sichuan and Guizhou, and possibly Shandong, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKPLLLLFFLGTINLSLCEEERDADEEERRDDPEERDVEVEKRFIVPSIFLLKKAF
CIALKKNC
|
| Length |
68 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKPLLLLFFLGTINLSLC |
| | |
| Prepro | | 25 | | EEERDADEEERRDDPEERDVEVEKR | | | | | Bioactive | Omeimontisin-B1 | 21 | No | FIVPSIFLLKKAFCIALKKNC | | | |
|