| Entry |
Temporin-OM1 |
| Uniprot code |
E1AZ77 |
| Fasta |
E1AZ77 |
| Peptide names |
Temporin-OM1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana omeimontis |
| Ecozone |
Palearctic |
| Distribution |
Mountains of Sichuan and Guizhou, and possibly Shandong, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINFSLCEEERNAEEERRDDPDERDVAVEKRLLPIVDNLLDGLLG K
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTINFSLC |
| | |
| Prepro | | 24 | | EEERNAEEERRDDPDERDVAVEKR | | | | | Bioactive | Temporin-OM1 | 13 | No | LLPIVDNLLDGLL | | | |
|