Entry |
Temporin-OM2 |
Uniprot code |
E1AZ78 |
Fasta |
E1AZ78 |
Peptide names |
Temporin-OM2 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Rana |
Species |
Rana omeimontis |
Ecozone |
Palearctic |
Distribution |
Mountains of Sichuan and Guizhou, and possibly Shandong, China |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTLKKPLLLLFFLGTINFSLCEEERNAEEERRDDPDERDVAVEKRLLPIVDNLLYGLLG K
|
Length |
61 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKPLLLLFFLGTINFSLC |
| | |
Prepro | | 24 | | EEERNAEEERRDDPDERDVAVEKR | | | | Bioactive | Temporin-OM2 | 13 | No | LLPIVDNLLYGLL | | | |
|