| Entry |
Temporin-LF3 |
| Uniprot code |
E1AZ87 |
| Fasta |
E1AZ87 |
| Peptide names |
Amolopin-2b Temporin-1CSa Temporin-GN3 Temporin-GN3_1 Temporin-LF3 Temporin-GN3_2 Temporin-1P Temporin-MT3 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops lifanensis |
| Ecozone |
Palearctic |
| Distribution |
Lishan and Maoxian and possibly into Wenchuan counties, central Sichuan, China, 1300-2350 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLATINLSLCEQERNAEEERRDEPDERNAEVEKRFLPIVGKLLSGLLG
K
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J.M. Conlon et al. / Peptides 28 (2007) 1268-1274. Peptide defenses of the Cascades frog Rana cascadae: implications for the evolutionary history of frogs of the Amerana species group |