| Entry |
Chunganensisin-A1 |
| Uniprot code |
E1B229 |
| Fasta |
E1B229 |
| Peptide names |
Chunganensisin-A1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops chunganensis |
| Ecozone |
Palearctic, Indomalaya |
| Distribution |
Widespread in isolated populations in southern Shaanxi, southern Gansu, eastern Sichuan, Guizhou, Guangxi, Hunan, and Fujian, China |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTTKKPLLLLFFLGMISLSLCKQERDANEERRDDPDENEETGGEAKVEEIKRAVRPPWR CKAAFC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTTKKPLLLLFFLGMISLSLC |
| | |
| Prepro | | 31 | | KQERDANEERRDDPDENEETGGEAKVEEIKR | | | | | Bioactive | Chunganensisin-A1 | 13 | No | AVRPPWRCKAAFC | | | |
|