| Entry |
Phylloseptin-1 |
| Uniprot code |
E3PQH3 |
| Fasta |
E3PQH3 |
| Peptide names |
Phylloseptin-1 PSN-1 |
| Suborder |
Neobatrachia |
| Family |
Hylidae |
| Genus |
Phyllomedusa |
| Species |
Phyllomedusa sauvagii |
| Ecozone |
Neotropic |
| Distribution |
The Chacoan region of eastern Bolivia, northern Paraguay, Mato Grosso do Sul (Brazil), and northern Argentina |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MDILKKSLFLVLFLGLVSLSICEEEKRETEEEEHDQEEDDKSEEKRFLSLIPHIVSGVAS
IAKHFG
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
R. Zhang et al. / Molecular Immunology 47 (2010) 2030-2037. Phylloseptin-1 (PSN-1) from Phyllomedusa sauvagei skin secretion: A novel broad-spectrum antimicrobial peptide with antibiofilm activity |