| Entry |
Brevinin-1-RAB3 |
| Uniprot code |
E3SYH1 |
| Fasta |
E3SYH1 |
| Peptide names |
Brevinin-1-RAB3 Brevinin-1-RAB4 Brevinin-1-RAB6 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKSLLLLFFLGTINLSLCEQERDADEEERRDDPEERDVEVEKRFLPLLAGLAVNFL
PKLFCKITRKC
|
| Length |
71 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTMKKSLLLLFFLGTINLSLC |
| | |
| Prepro | | 25 | | EQERDADEEERRDDPEERDVEVEKR | | | | | Bioactive | Brevinin-1-RAB3 | 24 | No | FLPLLAGLAVNFLPKLFCKITRKC | | | |
|