| Entry |
Brevinin-2-RA11 |
| Uniprot code |
E3SYJ5 |
| Fasta |
E3SYJ5 |
| Peptide names |
Brevinin-2E-MG1 Brevinin-2GRa Brevinin-2-RA11 Brevinin-2E-OG6 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKPLLLLFFLGTISLSLCEEERDADEDEGAEMTEEEVKRGLLDTFKNLALNAAKSA
GVSVLNSLSCKLSKTC
|
| Length |
76 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J.M. Conlon et al. / Peptides 27 (2006) 2111-2117. Antimicrobial peptides from diverse families isolated from the skin of the Asian frog, Rana grahami |