| Entry |
Nigrosin-RA2 |
| Uniprot code |
E3SYP6 |
| Fasta |
E3SYP6 |
| Peptide names |
Grahamin-1 Grahamin-2 Nigrocin-2GRa Nigrosin-OG20 Nigrosin-RA2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLFFLGTINLSFCQDETNAEEERRDEEVAKMEEIKRGLLSGILGAGKHIVC
GLSGLC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Xu et al. / Toxicon 47 (2006) 459-464. Two antimicrobial peptides from skin secretions of Rana grahami |