Entry |
Odorranain-A-RA1 |
Uniprot code |
E3SZ90 |
Fasta |
E3SZ90 |
Peptide names |
Odorranain-A3 Odorranain-A-RA1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana andersonii |
Ecozone |
Indomalaya |
Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
Antimicrobial & other activities |
mast cell degranulation, nitric oxide releasing, histamine releasing |
Tissue |
Skin |
Sequence |
MFPMKKPLLLLFFLGPISLSLCDQERDADEEEGSENGAEDIKLNRVVKCSYRLGSPDSRC N
|
Length |
61 |
Signal peptide class |
Class-1 |
References: |
2. for other activities |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |