| Entry |
Odorranain-A-RA1 |
| Uniprot code |
E3SZ95 |
| Fasta |
E3SZ95 |
| Peptide names |
Odorranain-A3 Odorranain-A-RA1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
mast cell degranulation, nitric oxide releasing, histamine releasing |
| Tissue |
Skin |
| Sequence |
MFPMKKSLLLLFFFGTISLSFCEQKRDAEEEEGSENGAEDIKLNRVVKCSYRLGSPDSRC N
|
| Length |
61 |
| Signal peptide class |
Class-1 |
| References: |
| 2. for other activities |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |