| Entry |
Odorranain-B-RA1 |
| Uniprot code |
E3SZA7 |
| Fasta |
E3SZA7 |
| Peptide names |
Odorranain-B-RA1 Ranacyclin B5 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial, antifungal, trypsin inhibitor |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGIVSLSSCEQERDADEEDGGEVTGEEVKRAALRGCWTKSIPPKPCS
GKR
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
X. Yan et al. / Amino Acids (2011) DOI 10.1007/s00726-011-1079-8. Bi-functional peptides with both trypsin-inhibitory and antimicrobial activities are frequent defensivemolecules in Ranidae amphibian skins |