Entry |
Odorranain-H-RA1 |
Uniprot code |
E3SZD3 |
Fasta |
E3SZD3 |
Peptide names |
Odorranain-H2 Odorranain-H-RA1 |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana andersonii |
Ecozone |
Indomalaya |
Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTMKKSLLLLFFLGTINLSLCQDEANAEEERRDEEVAKMEEIKRGIFGKILGVGKKVLC GLSGMC
|
Length |
66 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTMKKSLLLLFFLGTINLSLC |
| | |
Prepro | | 23 | | QDEANAEEERRDEEVAKMEEIKR | | | | Bioactive | Odorranain-H-RA1 | 21 | No | GIFGKILGVGKKVLCGLSGMC | | | |
|