| Entry |
Odorranain-U-RA |
| Uniprot code |
E3SZI4 |
| Fasta |
E3SZI4 |
| Peptide names |
Odorranain-U1 Odorranain-U-RA |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana andersonii |
| Ecozone |
Indomalaya |
| Distribution |
Northeastern India, Upper Myanmar, and northern Thailand to western Yunnan, China; south into Vietnam and Laos |
| Antimicrobial & other activities |
antibacterial, mast cell degranulation, nitric oxide releasing, histamine releasing, antifungal |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEQERDADEEGNEENGGEAKLEVVKRGCSRWIIGIHGQI
CRD
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTISLSLC |
| | |
| Prepro | | 25 | | EQERDADEEGNEENGGEAKLEVVKR | | | | | Bioactive | Odorranain-U-RA | 16 | No | GCSRWIIGIHGQICRD | | >55.00 | 41.34 |
|