| Entry | [Arg0, Trp5, Leu8]-bradykinin precursor |
| Uniprot code | E7AIL2 |
| Fasta | E7AIL2 |
| Peptide names | bradykinin precursor [Arg0, Trp5, Leu8]-bradykinin precursor |
| Suborder | Neobatrachia |
| Family | Ranidae |
| Genus | Rana |
| Species | Pelophylax esculentus |
| Ecozone | Palearctic |
| Distribution | Most of western, central and eastern Europe, Denmark and suthern most Sweden, Italy (river Po plain), up to 1550 m elevation. Introduced to United Kingdom and Spain. |
| Antimicrobial & other activities | contraction of arterial smooth muscle cells |
| Tissue | Skin |
| Sequence | MFTMKKSLLLFFFLGIVSLSLCKEERDADEEENEETGGEVKVEEVKRQKTYNRRPPGWSP LRIAPTNV |
| Length | 68 |
| Signal peptide class | Class-1 |
| References: | |
| 2. for other activities | X. Chen et al. / Peptides 32 (2011) 26-30. A fish bradykinin (Arg0, Trp5, Leu8-bradykinin) from the defensive skin secretion of the European edible frog, Pelophylax kl. esculentus: structural characterization; molecular cloning of skin kininogen cDNA and pharmacological effects on mammalian smooth muscle |
| Segment type | Name | Length | Amidated | Sequence | HC50 (μM) | MIC E. coli (μM) | MIC S. aureus (μM) |
| Signal | 22 | MFTMKKSLLLFFFLGIVSLSLC | |||||
| Prepro | 25 | KEERDADEEENEETGGEVKVEEVKR | |||||
| Bioactive | bradykinin precursor | 10 | No | RRPPGWSPLR |