Entry |
Esculentin-2V-HN1 |
Uniprot code |
E7EKC7 |
Fasta |
E7EKC7 |
Peptide names |
Esculentin-2V-HN1 Esculentin-2V |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Odorrana |
Species |
Odorrana hainanensis |
Ecozone |
Indomalaya |
Distribution |
Southern and southwestern Hainan Island, China, 200-900 m elevation |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTMKKPLLVLFFLGTISLSLCQEERAADEEDNGEVEEVKRGIFTLFKGAAKLLGKTLAK EAGKTGLELMACKVTNQC
|
Length |
78 |
Signal peptide class |
Class-1 |
References: |
1. for MIC/HC50 |
T. Chen et al. / Genomics 87 (2006) 638-644. Cloning from tissue surrogates: Antimicrobial peptide (esculentin) cDNAs from the defensive skin secretions of Chinese ranid frogs |