| Entry |
Hainanensin-1 |
| Uniprot code |
E7EKC9 |
| Fasta |
E7EKC9 |
| Peptide names |
Hainanensin-1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana hainanensis |
| Ecozone |
Indomalaya |
| Distribution |
Southern and southwestern Hainan Island, China, 200-900 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTISLSLCEQERNADEEERRDEEVAKVEEIKRSILSGIFGVGKKIV CGLSGLC
|
| Length |
67 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSMLLLFFLGTISLSLC |
| | |
| Prepro | | 24 | | EQERNADEEERRDEEVAKVEEIKR | | | | | Bioactive | Hainanensin-1 | 21 | No | SILSGIFGVGKKIVCGLSGLC | | | |
|