| Entry |
Odorranain-B1-HN1 |
| Uniprot code |
E7EKD9 |
| Fasta |
E7EKD9 |
| Peptide names |
Odorranain-B1-HN1 Odorranain-B1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Odorrana |
| Species |
Odorrana hainanensis |
| Ecozone |
Indomalaya |
| Distribution |
Southern and southwestern Hainan Island, China, 200-900 m elevation |
| Antimicrobial & other activities |
antibacterial, antifungal |
| Tissue |
Skin |
| Sequence |
MFTTKKPLLLLFFLGIISLSVCEQERDADEEDGGEVTEEEVKRAALKGCWTKSIPPKPCF
GKR
|
| Length |
63 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J. Li et al. / Molecular & Cellular Proteomics 6 (2007) 882-894. Anti-infection Peptidomics of Amphibian Skin |