| Entry |
Spinulosain-B1 |
| Uniprot code |
E7EKJ0 |
| Fasta |
E7EKJ0 |
| Peptide names |
Nigroain-H-SN1 Nigroain-H-SN1_2 Spinulosain-B1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana spinulosa |
| Ecozone |
Indomalaya |
| Distribution |
Southern and southwestern Hainan Island, China, 80-840 m elevation |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTISLSLCEEERDADEEDGGEVTEEAERDLQRRCKIALPYNMRCRV LGKC
|
| Length |
64 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTISLSLC |
| | |
| Prepro | | 25 | | EEERDADEEDGGEVTEEAERDLQRR | | | | | Bioactive | Spinulosain-B1 | 17 | No | CKIALPYNMRCRVLGKC | | | |
|