| Entry |
Temporin-LTa-SN1 |
| Uniprot code |
E7EKJ4 |
| Fasta |
E7EKJ4 |
| Peptide names |
Temporin-LTa Temporin-LTa-SN1 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Hylarana |
| Species |
Hylarana spinulosa |
| Ecozone |
Indomalaya |
| Distribution |
Southern and southwestern Hainan Island, China, 80-840 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTMKKPLLLLFFLGTINLSLCQEERNAEEERRDGDDEGGAEVQKRFFPLVLGALGSILP
KIFGK
|
| Length |
65 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
H. Wang et al. / Peptides 30 (2009) 273-282. The novel antimicrobial peptides from skin of Chinese broad-folded frog, Hylarana latouchii (Anura:Ranidae) |