| Entry |
Temporin-TR2_2 |
| Uniprot code |
E7EKL3 |
| Fasta |
E7EKL3 |
| Peptide names |
Temporin-TR2 Temporin-TR2_2 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops torrentis |
| Ecozone |
Indomalaya |
| Distribution |
Southwestern and central Hainan Island, China, 80-780 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTINLSLCEQGRDADEEERRDDPEERDVELEKRFLPLIGGILSQLL GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTINLSLC |
| | |
| Prepro | | 25 | | EQGRDADEEERRDDPEERDVELEKR | | | | | Bioactive | Temporin-TR2_2 | 13 | No | FLPLIGGILSQLL | | | |
|