| Entry |
Torrentin-B1 |
| Uniprot code |
E7EKL8 |
| Fasta |
E7EKL8 |
| Peptide names |
Torrentin-B1 Torrentin-B1_2 Torrentin-B1_3 |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Amolops |
| Species |
Amolops torrentis |
| Ecozone |
Indomalaya |
| Distribution |
Southwestern and central Hainan Island, China, 80-780 m elevation |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGMISLSLCEQERDANEERRDDGDESEANGGEVKVEEIKRGLRPPIR CKAAFC
|
| Length |
66 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGMISLSLC |
| | |
| Prepro | | 31 | | EQERDANEERRDDGDESEANGGEVKVEEIKR | | | | | Bioactive | Torrentin-B1 | 13 | No | GLRPPIRCKAAFC | | | |
|