Entry |
Preprochensinin-1CEc |
Uniprot code |
F1AEL5 |
Fasta |
F1AEL5 |
Peptide names |
Preprochensinin-1CEc Chensinin-1CEc |
Suborder |
Neobatrachia |
Family |
Ranidae |
Genus |
Rana |
Species |
Rana chensinensis |
Ecozone |
Palearctic |
Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
Antimicrobial & other activities |
antibacterial |
Tissue |
Skin |
Sequence |
MFTLKKSLLLLFFIGVIKLSLCEEERNADEEKRRDDPDEMDVEVEKRLALERRDGWLRLF GLKPRRKH
|
Length |
68 |
Signal peptide class |
Class-1 |
Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
Signal |
|
22 |
|
MFTLKKSLLLLFFIGVIKLSLC |
| | |
Prepro | | 25 | | EEERNADEEKRRDDPDEMDVEVEKR | | | | Bioactive | Chensinin-1CEc | 21 | No | LALERRDGWLRLFGLKPRRKH | | | |
|