| Entry |
Preprobrevinin-2CE |
| Uniprot code |
F1AEM1 |
| Fasta |
F1AEM1 |
| Peptide names |
Preprobrevinin-2CE Brevinin-2CE |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSMLLLFFLGTISLSLCQEEERGADEDEVIEEEVKRGLLSVFKGVLKTAGKNVAK
NVAGSLLDQLKCKISGGC
|
| Length |
78 |
| Signal peptide class |
Class-1 |
| References: |
| 1. for MIC/HC50 |
J. Zhao et al. / Zoological Science 28 (2011) 112-117. Molecular Cloning of Novel Antimicrobial Peptide Genes from the Skin of the Chinese Brown Frog, Rana chensinensis |