| Entry |
Preprotemporin-1CEd |
| Uniprot code |
F1AEM4 |
| Fasta |
F1AEM4 |
| Peptide names |
Preprotemporin-1CEd Temporin-1CEd |
| Suborder |
Neobatrachia |
| Family |
Ranidae |
| Genus |
Rana |
| Species |
Rana chensinensis |
| Ecozone |
Palearctic |
| Distribution |
Eastern Mongolia; north-central China (Shanxi) south to Sichuan and Hubei |
| Antimicrobial & other activities |
antibacterial |
| Tissue |
Skin |
| Sequence |
MFTLKKSLLLLFFLGTLNLSLCEEERNADEEERRDDPEEGAVKVEKRILPLIASLIGGLL
GK
|
| Length |
62 |
| Signal peptide class |
Class-1 |
| Segment type |
Name |
Length |
Amidated |
Sequence |
HC50 (μM) |
MIC E. coli (μM) |
MIC S. aureus (μM) |
| Signal |
|
22 |
|
MFTLKKSLLLLFFLGTLNLSLC |
| | |
| Prepro | | 25 | | EEERNADEEERRDDPEEGAVKVEKR | | | | | Bioactive | Temporin-1CEd | 15 | No | ILPLIASLIGGLLGK | | | |
|